Hello, I'm reporting many invalid contact to RIPE, APNIC, AFRINIC, ARIN, LACNIC. I made an error, the invalid contact which is related to you is: "abuse@ono.com" for IP 84.127.214.4. The issue is that the contact admin doesn't solve the abuse I encounter. Who should I contact if the RIPE database manager tell me he/she can't do anything and if you tell me you're not the right working group ? Thanks for your help. Regards. Jérôme Bouat a écrit :
Hello,
Your Whois database is providing "jhli_jl@mail.jl.cn" abuse contact email for IP 222.160.20.110.
However, the mailbox is full (see attached error message).
Please ensure each abuse complaint is processed by each network admin or remove useless contacts.
Sometimes the user account or the domain name is invalid in the provided email.
Thanks for you help.
Regards.
------------------------------------------------------------------------
Sujet: À´×Ô mail.jl.cn µÄÍËÐÅ Expéditeur: PostMaster@mail.jl.cn <> Date: Thu, 04 Jun 2009 16:50:21 +0800 Destinataire: jerome.bouat@wanadoo.fr
Destinataire: jerome.bouat@wanadoo.fr
ÒÔϵÄÓʼþ:
ÈÕÆÚ: Thu, 4 Jun 2009 10:56:00 +0200 (CEST) Ö÷Ìâ: Spam Complaint [Msg#14209, IP 222.160.20.110]; ´óС: 2683 bytes ×Ö½Ú ¶¯×÷: ʧ°Ü
ûÓÐÄܹ»·¢Ë͵½ÒÔϵÄÊÕ¼þÈË:
jhli_jl:mail "(0), ErrMsg=Too many mails in mailbox. Mail count (3030) reaches or exceeds upper limit (3000)."
²»»áÔÙÓÐÈκζ¯×÷À´³¢ÊÔ·¢ËÍÄãµÄÓʼþÁË¡£ ÇëÁªÏµÄãµÄϵͳ¹ÜÀíÔ±»òÏÈͨ¹ýÆäËü·Çµç×ÓÓʼþµÄ·½Ê½ÏòÄãµÄÅóÓÑ·¢ËÍÐÅÏ¢ÒÔÃâµ¢Îó¡£
------------------------------------------------------------------------
Sujet: Spam Complaint [Msg#14209, IP 222.160.20.110]; Expéditeur: jerome.bouat@wanadoo.fr Date: Thu, 4 Jun 2009 10:56:00 +0200 (CEST) Destinataire: abuse@chinaunicom.cn, abuse@cnc-noc.net, jhli_jl@mail.jl.cn
Destinataire: abuse@chinaunicom.cn, abuse@cnc-noc.net, jhli_jl@mail.jl.cn
I have attached an unsolicited e-mail sent to my computer. Please investigate and prevent recurrences by acting on your Acceptable Use Policy.
Your help is greatly appreciated.
Thank You
-------- Original Message --------
From - Thu Jun 4 10:20:54 2009 X-Account-Key:account2 X-UIDL:1186180440.17051 X-Mozilla-Status:0001 X-Mozilla-Status2:00000000 X-Mozilla-Keys: Return-Path:<JamesSherman@yyhmail.com> Received:from mwinf8208.laposte.net (mwinf8208.laposte.net) by mwinb7606 (SMTP Server) with LMTP; Thu, 04 Jun 2009 07:50:57 +0200 X-Sieve:Server Sieve 2.2 Received:from meplus.info (localhost [127.0.0.1]) by mwinf8208.laposte.net (SMTP Server) with ESMTP id 89C0E240008A; Thu, 4 Jun 2009 07:50:57 +0200 (CEST) Received:from 193.251.214.113 (unknown [222.160.20.110]) by mwinf8208.laposte.net (SMTP Server) with SMTP id 445C72400091; Thu, 4 Jun 2009 07:50:38 +0200 (CEST) X-ME-UUID:20090604055039280.445C72400091@mwinf8208.laposte.net Date:Thu, 04 Jun 2009 01:50:34 -0500 From:"Le sexe le potentiel +100 %" <LorenWray@amrer.net> Message-ID:<QD8965drumlin@innate.com> To:jerome.borde@laposte.net Subject:*** SPAM ***Re:Votre succ�s sexuel en 15 minutes. MIME-Version:1.0 Content-Type:text/html; charset=iso-8859-1 Content-Transfer-Encoding:7bit X-me-spamlevel:med X-me-spamrating:89.099998 X-me-spamcause:OK, (330)(1000)gggruggvucftvghtrhhoucdtuddrvdekvddrgeekucetggdotefuucfrrhhofhhilhgvmecuoehnohhnvgeqnecuuegrihhlohhuthemuceftddtnecujfhtmhhlqfhnlhihqddqqfdvkedvqdduvdculdeftddtmdennhhouchhohhsthcuuhhrlhculdeftddm